Lineage for d2azeb1 (2aze B:201-301)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 744517Fold e.63: E2F-DP heterodimerization region [144073] (1 superfamily)
    heterodimeric fold with the N-terminal long helices of both chains forming a parallel coiled coil and their C-terminal folded beta-hairpins interlocking together in a beta-sandwich
  4. 744518Superfamily e.63.1: E2F-DP heterodimerization region [144074] (2 families) (S)
  5. 744523Family e.63.1.2: E2F dimerization segment [144078] (1 protein)
    PfamB 001971
  6. 744524Protein Transcription factor E2F1 [144079] (1 species)
  7. 744525Species Human (Homo sapiens) [TaxId:9606] [144080] (1 PDB entry)
  8. 744526Domain d2azeb1: 2aze B:201-301 [127606]
    Other proteins in same PDB: d2azea1, d2azec1

Details for d2azeb1

PDB Entry: 2aze (more details), 2.55 Å

PDB Description: Structure of the Rb C-terminal domain bound to an E2F1-DP1 heterodimer
PDB Compounds: (B:) Transcription factor E2F1

SCOP Domain Sequences for d2azeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2azeb1 e.63.1.2 (B:201-301) Transcription factor E2F1 {Human (Homo sapiens) [TaxId: 9606]}
grlegltqdlrqlqeseqqldhlmnicttqlrllsedtdsqrlayvtcqdlrsiadpaeq
mvmvikappetqlqavdssenfqislkskqgpidvflcpee

SCOP Domain Coordinates for d2azeb1:

Click to download the PDB-style file with coordinates for d2azeb1.
(The format of our PDB-style files is described here.)

Timeline for d2azeb1: