Lineage for d2azea1 (2aze A:199-346)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 744517Fold e.63: E2F-DP heterodimerization region [144073] (1 superfamily)
    heterodimeric fold with the N-terminal long helices of both chains forming a parallel coiled coil and their C-terminal folded beta-hairpins interlocking together in a beta-sandwich
  4. 744518Superfamily e.63.1: E2F-DP heterodimerization region [144074] (2 families) (S)
  5. 744519Family e.63.1.1: DP dimerization segment [144075] (1 protein)
    Pfam PF08781
  6. 744520Protein Transcription factor DP-1 [144076] (1 species)
  7. 744521Species Human (Homo sapiens) [TaxId:9606] [144077] (1 PDB entry)
  8. 744522Domain d2azea1: 2aze A:199-346 [127605]
    Other proteins in same PDB: d2azeb1, d2azec1

Details for d2azea1

PDB Entry: 2aze (more details), 2.55 Å

PDB Description: Structure of the Rb C-terminal domain bound to an E2F1-DP1 heterodimer
PDB Compounds: (A:) Transcription factor Dp-1

SCOP Domain Sequences for d2azea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2azea1 e.63.1.1 (A:199-346) Transcription factor DP-1 {Human (Homo sapiens) [TaxId: 9606]}
aqecqnleverqrrlerikqkqsqlqelilqqiafknlvqrnrhaeqqasrppppnsvih
lpfiivntskktvidcsisndkfeylfnfdntfeihddievlkrmgmacglesgscsaed
lkmarslvpkalepyvtemaqgtvggvf

SCOP Domain Coordinates for d2azea1:

Click to download the PDB-style file with coordinates for d2azea1.
(The format of our PDB-style files is described here.)

Timeline for d2azea1: