Lineage for d2azec1 (2aze C:829-872)

  1. Root: SCOP 1.73
  2. 756025Class j: Peptides [58231] (120 folds)
  3. 757698Fold j.119: Retinoblastoma-associated protein RB1 fragments [144325] (1 superfamily)
  4. 757699Superfamily j.119.1: Retinoblastoma-associated protein RB1 fragments [144326] (1 family) (S)
  5. 757700Family j.119.1.1: Retinoblastoma-associated protein RB1 fragments [144327] (1 protein)
  6. 757701Protein Retinoblastoma-associated protein RB1 fragments [144328] (1 species)
  7. 757702Species Human (Homo sapiens) [TaxId:9606] [144329] (1 PDB entry)
  8. 757703Domain d2azec1: 2aze C:829-872 [127607]
    Other proteins in same PDB: d2azea1, d2azeb1
    near C-terminal fragment bound to the E2F1-DP1 heterodimer

Details for d2azec1

PDB Entry: 2aze (more details), 2.55 Å

PDB Description: Structure of the Rb C-terminal domain bound to an E2F1-DP1 heterodimer
PDB Compounds: (C:) Retinoblastoma-associated protein

SCOP Domain Sequences for d2azec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2azec1 j.119.1.1 (C:829-872) Retinoblastoma-associated protein RB1 fragments {Human (Homo sapiens) [TaxId: 9606]}
srilvsigesfgtsekfqkinqmvcnsdrvlkrsaegsnppkpl

SCOP Domain Coordinates for d2azec1:

Click to download the PDB-style file with coordinates for d2azec1.
(The format of our PDB-style files is described here.)

Timeline for d2azec1: