Lineage for d2aroa_ (2aro A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. Protein Histone H2A [47115] (7 species)
  7. Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (6 PDB entries)
    Uniprot P02263
  8. Domain d2aroa_: 2aro A: [127209]
    Other proteins in same PDB: d2arob_, d2aroc_, d2arod_, d2arof_, d2arog_, d2aroh_
    automated match to d1kx5c_
    complexed with cl, po4

Details for d2aroa_

PDB Entry: 2aro (more details), 2.1 Å

PDB Description: Crystal Structure Of The Native Histone Octamer To 2.1 Angstrom Resolution, Crystalised In The Presence Of S-Nitrosoglutathione
PDB Compounds: (A:) histone h2a-IV

SCOPe Domain Sequences for d2aroa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aroa_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
kaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaard
nkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpk

SCOPe Domain Coordinates for d2aroa_ are not available.

Timeline for d2aroa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2arob_, d2aroc_, d2arod_, d2aroe_, d2arof_, d2arog_, d2aroh_