Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2A [47115] (7 species) |
Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (6 PDB entries) Uniprot P02263 |
Domain d2aroa_: 2aro A: [127209] Other proteins in same PDB: d2arob_, d2aroc_, d2arod_, d2arof_, d2arog_, d2aroh_ automated match to d1kx5c_ complexed with cl, po4 |
PDB Entry: 2aro (more details), 2.1 Å
SCOPe Domain Sequences for d2aroa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aroa_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} kaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaard nkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpk
Timeline for d2aroa_: