Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (7 species) |
Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (6 PDB entries) Uniprot P62801 |
Domain d2aroh_: 2aro H: [127216] Other proteins in same PDB: d2aroa_, d2arob_, d2aroc_, d2aroe_, d2arof_, d2arog_ automated match to d1kx5b_ complexed with cl, po4 |
PDB Entry: 2aro (more details), 2.1 Å
SCOPe Domain Sequences for d2aroh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aroh_ a.22.1.1 (H:) Histone H4 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr ktvtamdvvyalkrqgrtlygfgg
Timeline for d2aroh_: