Lineage for d2aroh_ (2aro H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698446Protein Histone H4 [47125] (7 species)
  7. 2698538Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (6 PDB entries)
    Uniprot P62801
  8. 2698542Domain d2aroh_: 2aro H: [127216]
    Other proteins in same PDB: d2aroa_, d2arob_, d2aroc_, d2aroe_, d2arof_, d2arog_
    automated match to d1kx5b_
    complexed with cl, po4

Details for d2aroh_

PDB Entry: 2aro (more details), 2.1 Å

PDB Description: Crystal Structure Of The Native Histone Octamer To 2.1 Angstrom Resolution, Crystalised In The Presence Of S-Nitrosoglutathione
PDB Compounds: (H:) histone h4-vi

SCOPe Domain Sequences for d2aroh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aroh_ a.22.1.1 (H:) Histone H4 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
ktvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d2aroh_:

Click to download the PDB-style file with coordinates for d2aroh_.
(The format of our PDB-style files is described here.)

Timeline for d2aroh_: