PDB entry 2aro

View 2aro on RCSB PDB site
Description: Crystal Structure Of The Native Histone Octamer To 2.1 Angstrom Resolution, Crystalised In The Presence Of S-Nitrosoglutathione
Class: structural protein
Keywords: octamer, oxidation, allostery, circular dichroism, structural protein
Deposited on 2005-08-20, released 2005-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.186
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone h2a-IV
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aroa_
  • Chain 'B':
    Compound: histone h2b
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2arob_
  • Chain 'C':
    Compound: histone h3
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aroc_
  • Chain 'D':
    Compound: histone h4-vi
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2arod_
  • Chain 'E':
    Compound: histone h2a-IV
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aroe_
  • Chain 'F':
    Compound: histone h2b
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2arof_
  • Chain 'G':
    Compound: histone h3
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2arog_
  • Chain 'H':
    Compound: histone h4-vi
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aroh_
  • Heterogens: PO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aroA (A:)
    msgrgkqggkarakaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylt
    aeilelagnaardnkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpkk
    tdshkakak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aroA (A:)
    kaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaard
    nkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aroB (B:)
    mpepaksapapkkgskkavtktqkkgdkkrkksrkesysiyvykvlkqvhpdtgisskam
    gimnsfvndiferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavt
    kytssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aroB (B:)
    rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsr
    eiqtavrlllpgelakhavsegtkavtkytss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2aroC (C:)
    martkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aroC (C:)
    yrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseayl
    vglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2aroD (D:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aroD (D:)
    kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
    tvtamdvvyalkrqgrtlygfgg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2aroE (E:)
    msgrgkqggkarakaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylt
    aeilelagnaardnkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpkk
    tdshkakak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aroE (E:)
    aksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
    kktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2aroF (F:)
    mpepaksapapkkgskkavtktqkkgdkkrkksrkesysiyvykvlkqvhpdtgisskam
    gimnsfvndiferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavt
    kytssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aroF (F:)
    rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsr
    eiqtavrlllpgelakhavsegtkavtkytssk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2aroG (G:)
    martkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aroG (G:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2aroH (H:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aroH (H:)
    rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
    ktvtamdvvyalkrqgrtlygfgg