SCOPe 2.04: Domain d2acfb_: 2acf B:

Lineage for d2acfb_ (2acf B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (3 families)

5. Family c.50.1.2: Macro domain [89724] (7 proteins)
   found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme

6. Protein automated matches [190472] (4 species)
   not a true protein

7. Species Sars coronavirus tor2 [TaxId:227984] [187392] (1 PDB entry)

8. Domain d2acfb_: 2acf B: [126548]
   Other proteins in same PDB: d2acfa1
   automated match to d2acfa1
   complexed with gol

Details for d2acfb_

PDB Entry: 2acf, 1.4 Å

PDB Description: nmr structure of sars-cov non-structural protein nsp3a (sars1) from sars coronavirus

PDB Compounds: (B:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d2acfb_:

Sequence; same for both SEQRES and ATOM records:

>d2acfb_ c.50.1.2 (B:) automated matches {Sars coronavirus tor2 [TaxId: 227984]}
mpvnqftgylkltdnvaikcvdivkeaqsanpmvivnaanihlkhgggvagalnkatnga
mqkesddyiklngpltvggscllsghnlakkclhvvgpnlnagediqllkaayenfnsqd
illapllsagifgakplqslqvcvqtvrtqvyiavndkalyeqvvmdyldnlk

Timeline for d2acfb_:

• d2acfb_ first appeared in SCOP 1.73, called d2acfb1
  
• d2acfb_ appears in SCOPe 2.03
  
• d2acfb_ appears in SCOPe 2.05
  
• d2acfb_ appears in the current release, SCOPe 2.08, called d2acfb2