| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (4 families) ![]() |
| Family c.50.1.2: Macro domain [89724] (7 proteins) found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme |
| Protein automated matches [190472] (8 species) not a true protein |
| Species Sars coronavirus tor2 [TaxId:227984] [187392] (1 PDB entry) |
| Domain d2acfb2: 2acf B:184-355 [126548] Other proteins in same PDB: d2acfa1, d2acfa2, d2acfb3, d2acfc3, d2acfd3 automated match to d2acfa1 complexed with gol |
PDB Entry: 2acf (more details), 1.4 Å
SCOPe Domain Sequences for d2acfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2acfb2 c.50.1.2 (B:184-355) automated matches {Sars coronavirus tor2 [TaxId: 227984]}
pvnqftgylkltdnvaikcvdivkeaqsanpmvivnaanihlkhgggvagalnkatngam
qkesddyiklngpltvggscllsghnlakkclhvvgpnlnagediqllkaayenfnsqdi
llapllsagifgakplqslqvcvqtvrtqvyiavndkalyeqvvmdyldnlk
Timeline for d2acfb2: