| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (4 families) ![]() |
| Family c.50.1.2: Macro domain [89724] (7 proteins) found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme |
| Protein Replicase polyprotein 1ab [142550] (1 species) |
| Species SARS coronavirus [TaxId:227859] [142551] (1 PDB entry) Uniprot P59641 1002-1169 |
| Domain d2acfa1: 2acf A:183-351 [126547] Other proteins in same PDB: d2acfa2, d2acfb2, d2acfb3, d2acfc2, d2acfc3, d2acfd2, d2acfd3 complexed with gol |
PDB Entry: 2acf (more details), 1.4 Å
SCOPe Domain Sequences for d2acfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2acfa1 c.50.1.2 (A:183-351) Replicase polyprotein 1ab {SARS coronavirus [TaxId: 227859]}
mpvnqftgylkltdnvaikcvdivkeaqsanpmvivnaanihlkhgggvagalnkatnga
mqkesddyiklngpltvggscllsghnlakkclhvvgpnlnagediqllkaayenfnsqd
illapllsagifgakplqslqvcvqtvrtqvyiavndkalyeqvvmdyl
Timeline for d2acfa1: