Lineage for d2acfb1 (2acf B:184-351)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 700532Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 700533Superfamily c.50.1: Macro domain-like [52949] (2 families) (S)
  5. 700560Family c.50.1.2: Macro domain [89724] (6 proteins)
    found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme
  6. 700596Protein Replicase polyprotein 1ab [142550] (1 species)
  7. 700597Species SARS coronavirus [TaxId:227859] [142551] (1 PDB entry)
  8. 700599Domain d2acfb1: 2acf B:184-351 [126548]
    automatically matched to 2ACF A:184-351
    complexed with gol

Details for d2acfb1

PDB Entry: 2acf (more details), 1.4 Å

PDB Description: nmr structure of sars-cov non-structural protein nsp3a (sars1) from sars coronavirus
PDB Compounds: (B:) Replicase polyprotein 1ab

SCOP Domain Sequences for d2acfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2acfb1 c.50.1.2 (B:184-351) Replicase polyprotein 1ab {SARS coronavirus [TaxId: 227859]}
pvnqftgylkltdnvaikcvdivkeaqsanpmvivnaanihlkhgggvagalnkatngam
qkesddyiklngpltvggscllsghnlakkclhvvgpnlnagediqllkaayenfnsqdi
llapllsagifgakplqslqvcvqtvrtqvyiavndkalyeqvvmdyl

SCOP Domain Coordinates for d2acfb1:

Click to download the PDB-style file with coordinates for d2acfb1.
(The format of our PDB-style files is described here.)

Timeline for d2acfb1: