Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (2 families) |
Family c.50.1.2: Macro domain [89724] (6 proteins) found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme |
Protein Replicase polyprotein 1ab [142550] (1 species) |
Species SARS coronavirus [TaxId:227859] [142551] (1 PDB entry) |
Domain d2acfb1: 2acf B:184-351 [126548] automatically matched to 2ACF A:184-351 complexed with gol |
PDB Entry: 2acf (more details), 1.4 Å
SCOP Domain Sequences for d2acfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2acfb1 c.50.1.2 (B:184-351) Replicase polyprotein 1ab {SARS coronavirus [TaxId: 227859]} pvnqftgylkltdnvaikcvdivkeaqsanpmvivnaanihlkhgggvagalnkatngam qkesddyiklngpltvggscllsghnlakkclhvvgpnlnagediqllkaayenfnsqdi llapllsagifgakplqslqvcvqtvrtqvyiavndkalyeqvvmdyl
Timeline for d2acfb1: