![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
![]() | Superfamily c.50.1: Macro domain-like [52949] (3 families) ![]() |
![]() | Family c.50.1.2: Macro domain [89724] (7 proteins) found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme |
![]() | Protein Replicase polyprotein 1ab [142550] (1 species) |
![]() | Species SARS coronavirus [TaxId:227859] [142551] (1 PDB entry) Uniprot P59641 1002-1169 |
![]() | Domain d2acfa1: 2acf A:184-351 [126547] Other proteins in same PDB: d2acfb_, d2acfc_, d2acfd_ complexed with gol |
PDB Entry: 2acf (more details), 1.4 Å
SCOPe Domain Sequences for d2acfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2acfa1 c.50.1.2 (A:184-351) Replicase polyprotein 1ab {SARS coronavirus [TaxId: 227859]} pvnqftgylkltdnvaikcvdivkeaqsanpmvivnaanihlkhgggvagalnkatngam qkesddyiklngpltvggscllsghnlakkclhvvgpnlnagediqllkaayenfnsqdi llapllsagifgakplqslqvcvqtvrtqvyiavndkalyeqvvmdyl
Timeline for d2acfa1: