SCOPe 2.05: Domain d2acfa1: 2acf A:184-351

Lineage for d2acfa1 (2acf A:184-351)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (3 families)

5. Family c.50.1.2: Macro domain [89724] (7 proteins)
   found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme

6. Protein Replicase polyprotein 1ab [142550] (1 species)

7. Species SARS coronavirus [TaxId:227859] [142551] (1 PDB entry)
   Uniprot P59641 1002-1169

8. Domain d2acfa1: 2acf A:184-351 [126547]
   Other proteins in same PDB: d2acfb_, d2acfc_, d2acfd_
   complexed with gol

Details for d2acfa1

PDB Entry: 2acf, 1.4 Å

PDB Description: nmr structure of sars-cov non-structural protein nsp3a (sars1) from sars coronavirus

PDB Compounds: (A:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d2acfa1:

Sequence; same for both SEQRES and ATOM records:

>d2acfa1 c.50.1.2 (A:184-351) Replicase polyprotein 1ab {SARS coronavirus [TaxId: 227859]}
pvnqftgylkltdnvaikcvdivkeaqsanpmvivnaanihlkhgggvagalnkatngam
qkesddyiklngpltvggscllsghnlakkclhvvgpnlnagediqllkaayenfnsqdi
llapllsagifgakplqslqvcvqtvrtqvyiavndkalyeqvvmdyl

Timeline for d2acfa1:

• d2acfa1 first appeared in SCOP 1.73
  
• d2acfa1 appears in SCOPe 2.04
  
• d2acfa1 appears in SCOPe 2.06
  
• d2acfa1 appears in the current release, SCOPe 2.08