Lineage for d2acfa1 (2acf A:184-351)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1603758Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 1603759Superfamily c.50.1: Macro domain-like [52949] (3 families) (S)
  5. 1603784Family c.50.1.2: Macro domain [89724] (7 proteins)
    found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme
  6. 1603820Protein Replicase polyprotein 1ab [142550] (1 species)
  7. 1603821Species SARS coronavirus [TaxId:227859] [142551] (1 PDB entry)
    Uniprot P59641 1002-1169
  8. 1603822Domain d2acfa1: 2acf A:184-351 [126547]
    Other proteins in same PDB: d2acfb_, d2acfc_, d2acfd_
    complexed with gol

Details for d2acfa1

PDB Entry: 2acf (more details), 1.4 Å

PDB Description: nmr structure of sars-cov non-structural protein nsp3a (sars1) from sars coronavirus
PDB Compounds: (A:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d2acfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2acfa1 c.50.1.2 (A:184-351) Replicase polyprotein 1ab {SARS coronavirus [TaxId: 227859]}
pvnqftgylkltdnvaikcvdivkeaqsanpmvivnaanihlkhgggvagalnkatngam
qkesddyiklngpltvggscllsghnlakkclhvvgpnlnagediqllkaayenfnsqdi
llapllsagifgakplqslqvcvqtvrtqvyiavndkalyeqvvmdyl

SCOPe Domain Coordinates for d2acfa1:

Click to download the PDB-style file with coordinates for d2acfa1.
(The format of our PDB-style files is described here.)

Timeline for d2acfa1: