| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.23: USP8 N-terminal domain-like [140856] (1 family) ![]() |
| Family a.118.23.1: USP8 N-terminal domain-like [140857] (1 protein) PfamB PB029795 |
| Protein Ubiquitin carboxyl-terminal hydrolase 8, USH8 [140858] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [140859] (1 PDB entry) Uniprot P40818 6-139 |
| Domain d2a9ub_: 2a9u B: [126451] automated match to d2a9ua1 |
PDB Entry: 2a9u (more details), 2.1 Å
SCOPe Domain Sequences for d2a9ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a9ub_ a.118.23.1 (B:) Ubiquitin carboxyl-terminal hydrolase 8, USH8 {Human (Homo sapiens) [TaxId: 9606]}
svpkelylssslkdlnkktevkpekistksyvhsalkifktaeecrldrdeerayvlymk
yvtvynlikkrpdfkqqqdyfhsilgpgnikkaveeaerlseslklryeeaevrkkleek
drqeeaq
Timeline for d2a9ub_: