SCOPe 2.08: Domain d2a9ub_: 2a9u B:

Lineage for d2a9ub_ (2a9u B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.23: USP8 N-terminal domain-like [140856] (1 family)

5. Family a.118.23.1: USP8 N-terminal domain-like [140857] (1 protein)
   PfamB PB029795

6. Protein Ubiquitin carboxyl-terminal hydrolase 8, USH8 [140858] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140859] (1 PDB entry)
   Uniprot P40818 6-139

8. Domain d2a9ub_: 2a9u B: [126451]
   automated match to d2a9ua1

Details for d2a9ub_

PDB Entry: 2a9u, 2.1 Å

PDB Description: Structure of the N-terminal domain of Human Ubiquitin carboxyl-terminal hydrolase 8 (USP8)

PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase 8

SCOPe Domain Sequences for d2a9ub_:

Sequence; same for both SEQRES and ATOM records:

>d2a9ub_ a.118.23.1 (B:) Ubiquitin carboxyl-terminal hydrolase 8, USH8 {Human (Homo sapiens) [TaxId: 9606]}
svpkelylssslkdlnkktevkpekistksyvhsalkifktaeecrldrdeerayvlymk
yvtvynlikkrpdfkqqqdyfhsilgpgnikkaveeaerlseslklryeeaevrkkleek
drqeeaq

Timeline for d2a9ub_:

• d2a9ub_ first appeared in SCOP 1.73, called d2a9ub1
  
• d2a9ub_ appears in SCOPe 2.07