SCOP 1.73: Domain d2a9ub1: 2a9u B:6-132

Lineage for d2a9ub1 (2a9u B:6-132)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.23: USP8 N-terminal domain-like [140856] (1 family)

5. Family a.118.23.1: USP8 N-terminal domain-like [140857] (1 protein)
   PfamB 029795

6. Protein Ubiquitin carboxyl-terminal hydrolase 8, USH8 [140858] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140859] (1 PDB entry)

8. Domain d2a9ub1: 2a9u B:6-132 [126451]
   automatically matched to 2A9U A:6-139

Details for d2a9ub1

PDB Entry: 2a9u, 2.1 Å

PDB Description: Structure of the N-terminal domain of Human Ubiquitin carboxyl-terminal hydrolase 8 (USP8)

PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase 8

SCOP Domain Sequences for d2a9ub1:

Sequence; same for both SEQRES and ATOM records:

>d2a9ub1 a.118.23.1 (B:6-132) Ubiquitin carboxyl-terminal hydrolase 8, USH8 {Human (Homo sapiens) [TaxId: 9606]}
svpkelylssslkdlnkktevkpekistksyvhsalkifktaeecrldrdeerayvlymk
yvtvynlikkrpdfkqqqdyfhsilgpgnikkaveeaerlseslklryeeaevrkkleek
drqeeaq

Timeline for d2a9ub1:

• d2a9ub1 is new in SCOP 1.73
  
• d2a9ub1 appears in SCOP 1.75
  
• d2a9ub1 appears in the current release, SCOPe 2.08, called d2a9ub_