Lineage for d2a9ub_ (2a9u B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340555Superfamily a.118.23: USP8 N-terminal domain-like [140856] (1 family) (S)
  5. 2340556Family a.118.23.1: USP8 N-terminal domain-like [140857] (1 protein)
    PfamB PB029795
  6. 2340557Protein Ubiquitin carboxyl-terminal hydrolase 8, USH8 [140858] (1 species)
  7. 2340558Species Human (Homo sapiens) [TaxId:9606] [140859] (1 PDB entry)
    Uniprot P40818 6-139
  8. 2340560Domain d2a9ub_: 2a9u B: [126451]
    automated match to d2a9ua1

Details for d2a9ub_

PDB Entry: 2a9u (more details), 2.1 Å

PDB Description: Structure of the N-terminal domain of Human Ubiquitin carboxyl-terminal hydrolase 8 (USP8)
PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase 8

SCOPe Domain Sequences for d2a9ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9ub_ a.118.23.1 (B:) Ubiquitin carboxyl-terminal hydrolase 8, USH8 {Human (Homo sapiens) [TaxId: 9606]}
svpkelylssslkdlnkktevkpekistksyvhsalkifktaeecrldrdeerayvlymk
yvtvynlikkrpdfkqqqdyfhsilgpgnikkaveeaerlseslklryeeaevrkkleek
drqeeaq

SCOPe Domain Coordinates for d2a9ub_:

Click to download the PDB-style file with coordinates for d2a9ub_.
(The format of our PDB-style files is described here.)

Timeline for d2a9ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2a9ua1