Lineage for d2a9ua1 (2a9u A:6-139)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.23: USP8 N-terminal domain-like [140856] (1 family) 
Family a.118.23.1: USP8 N-terminal domain-like [140857] (1 protein)
PfamB PB029795Protein Ubiquitin carboxyl-terminal hydrolase 8, USH8 [140858] (1 species) Species Human (Homo sapiens) [TaxId:9606] [140859] (1 PDB entry)
Uniprot P40818 6-139
Domain d2a9ua1: 2a9u A:6-139 [126450]
Details for d2a9ua1
PDB Entry: 2a9u (more details), 2.1 Å
PDB Description: Structure of the N-terminal domain of Human Ubiquitin carboxyl-terminal hydrolase 8 (USP8)
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 8SCOPe Domain Sequences for d2a9ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a9ua1 a.118.23.1 (A:6-139) Ubiquitin carboxyl-terminal hydrolase 8, USH8 {Human (Homo sapiens) [TaxId: 9606]}
svpkelylssslkdlnkktevkpekistksyvhsalkifktaeecrldrdeerayvlymk
yvtvynlikkrpdfkqqqdyfhsilgpgnikkaveeaerlseslklryeeaevrkkleek
drqeeaqrlqqkrq
SCOPe Domain Coordinates for d2a9ua1:
Click to download the PDB-style file with coordinates for d2a9ua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2a9ua1:
- d2a9ua1 first appeared in SCOP 1.73
- d2a9ua1 appears in SCOPe 2.07
View in 3D
