Lineage for d2a69p3 (2a69 P:74-257)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779761Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 779762Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (1 family) (S)
  5. 779763Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (5 proteins)
  6. 779779Protein Sigma70 [88948] (2 species)
  7. 779782Species Thermus thermophilus [TaxId:274] [88949] (9 PDB entries)
    Uniprot Q9WX78
  8. 779790Domain d2a69p3: 2a69 P:74-257 [126230]
    Other proteins in same PDB: d2a69a1, d2a69a2, d2a69b1, d2a69b2, d2a69c1, d2a69d1, d2a69e1, d2a69f1, d2a69f2, d2a69k1, d2a69k2, d2a69l1, d2a69l2, d2a69m1, d2a69n1, d2a69o1, d2a69p1, d2a69p2
    automatically matched to d1iw7f3
    complexed with mg, rpt, zn

Details for d2a69p3

PDB Entry: 2a69 (more details), 2.5 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic rifapentin
PDB Compounds: (P:) RNA polymerase sigma factor rpoD

SCOP Domain Sequences for d2a69p3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a69p3 a.177.1.1 (P:74-257) Sigma70 {Thermus thermophilus [TaxId: 274]}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qart

SCOP Domain Coordinates for d2a69p3:

Click to download the PDB-style file with coordinates for d2a69p3.
(The format of our PDB-style files is described here.)

Timeline for d2a69p3: