Lineage for d2a69p2 (2a69 P:319-423)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 763476Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 763509Family a.4.13.2: Sigma4 domain [88665] (4 proteins)
  6. 763517Protein Sigma70 (SigA, RpoD) [88666] (4 species)
  7. 763528Species Thermus thermophilus [TaxId:274] [88667] (9 PDB entries)
    Uniprot Q9WX78
  8. 763536Domain d2a69p2: 2a69 P:319-423 [126229]
    Other proteins in same PDB: d2a69a1, d2a69a2, d2a69b1, d2a69b2, d2a69c1, d2a69d1, d2a69e1, d2a69f1, d2a69f3, d2a69k1, d2a69k2, d2a69l1, d2a69l2, d2a69m1, d2a69n1, d2a69o1, d2a69p1, d2a69p3
    automatically matched to d1iw7f2
    complexed with mg, rpt, zn

Details for d2a69p2

PDB Entry: 2a69 (more details), 2.5 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic rifapentin
PDB Compounds: (P:) RNA polymerase sigma factor rpoD

SCOP Domain Sequences for d2a69p2:

Sequence, based on SEQRES records: (download)

>d2a69p2 a.4.13.2 (P:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld

Sequence, based on observed residues (ATOM records): (download)

>d2a69p2 a.4.13.2 (P:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
eevgaffgvtrerirqienkalrklkyhesrtrklrdfld

SCOP Domain Coordinates for d2a69p2:

Click to download the PDB-style file with coordinates for d2a69p2.
(The format of our PDB-style files is described here.)

Timeline for d2a69p2: