|  | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) | 
|  | Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit | 
|  | Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)  | 
|  | Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins) | 
|  | Protein RNA polymerase alpha subunit [56555] (3 species) | 
|  | Species Thermus thermophilus [TaxId:274] [75595] (9 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit | 
|  | Domain d2a69b2: 2a69 B:50-172 [126214] Other proteins in same PDB: d2a69a1, d2a69b1, d2a69c1, d2a69d1, d2a69e1, d2a69f1, d2a69f2, d2a69f3, d2a69k1, d2a69l1, d2a69m1, d2a69n1, d2a69o1, d2a69p1, d2a69p2, d2a69p3 automatically matched to d1iw7a2 complexed with mg, rpt, zn | 
PDB Entry: 2a69 (more details), 2.5 Å
SCOP Domain Sequences for d2a69b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a69b2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs
Timeline for d2a69b2: