SCOP 1.75: Domain d2a69k2: 2a69 K:50-172

Lineage for d2a69k2 (2a69 K:50-172)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)

6. Protein RNA polymerase alpha subunit [56555] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75595] (9 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d2a69k2: 2a69 K:50-172 [126222]
   Other proteins in same PDB: d2a69a1, d2a69b1, d2a69c1, d2a69d1, d2a69e1, d2a69f1, d2a69f2, d2a69f3, d2a69k1, d2a69l1, d2a69m1, d2a69n1, d2a69o1, d2a69p1, d2a69p2, d2a69p3
   automatically matched to d1iw7a2
   complexed with mg, rpt, zn

Details for d2a69k2

PDB Entry: 2a69, 2.5 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic rifapentin

PDB Compounds: (K:) DNA-directed RNA polymerase alpha chain

SCOP Domain Sequences for d2a69k2:

Sequence; same for both SEQRES and ATOM records:

>d2a69k2 d.181.1.1 (K:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

Timeline for d2a69k2:

• d2a69k2 first appeared in SCOP 1.73
  
• d2a69k2 appears in SCOPe 2.01
  
• d2a69k2 appears in the current release, SCOPe 2.08