Lineage for d2a69k2 (2a69 K:50-172)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879236Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 879237Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 879238Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 879239Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 879254Species Thermus thermophilus [TaxId:274] [75595] (9 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 879269Domain d2a69k2: 2a69 K:50-172 [126222]
    Other proteins in same PDB: d2a69a1, d2a69b1, d2a69c1, d2a69d1, d2a69e1, d2a69f1, d2a69f2, d2a69f3, d2a69k1, d2a69l1, d2a69m1, d2a69n1, d2a69o1, d2a69p1, d2a69p2, d2a69p3
    automatically matched to d1iw7a2
    complexed with mg, rpt, zn

Details for d2a69k2

PDB Entry: 2a69 (more details), 2.5 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic rifapentin
PDB Compounds: (K:) DNA-directed RNA polymerase alpha chain

SCOP Domain Sequences for d2a69k2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a69k2 d.181.1.1 (K:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOP Domain Coordinates for d2a69k2:

Click to download the PDB-style file with coordinates for d2a69k2.
(The format of our PDB-style files is described here.)

Timeline for d2a69k2: