Lineage for d2a69f1 (2a69 F:258-318)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 763476Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 763477Family a.4.13.1: Sigma3 domain [88660] (3 proteins)
  6. 763489Protein Sigma70 [88661] (1 species)
  7. 763490Species Thermus thermophilus [TaxId:274] [88662] (9 PDB entries)
    Uniprot Q9WX78
  8. 763497Domain d2a69f1: 2a69 F:258-318 [126218]
    Other proteins in same PDB: d2a69a1, d2a69a2, d2a69b1, d2a69b2, d2a69c1, d2a69d1, d2a69e1, d2a69f2, d2a69f3, d2a69k1, d2a69k2, d2a69l1, d2a69l2, d2a69m1, d2a69n1, d2a69o1, d2a69p2, d2a69p3
    automatically matched to d1iw7f1
    complexed with mg, rpt, zn

Details for d2a69f1

PDB Entry: 2a69 (more details), 2.5 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic rifapentin
PDB Compounds: (F:) RNA polymerase sigma factor rpoD

SCOP Domain Sequences for d2a69f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a69f1 a.4.13.1 (F:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

SCOP Domain Coordinates for d2a69f1:

Click to download the PDB-style file with coordinates for d2a69f1.
(The format of our PDB-style files is described here.)

Timeline for d2a69f1: