| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (1 family) ![]() |
| Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (5 proteins) |
| Protein Sigma70 [88948] (2 species) |
| Species Thermus thermophilus [TaxId:274] [88949] (9 PDB entries) Uniprot Q9WX78 |
| Domain d2a69f3: 2a69 F:74-257 [126220] Other proteins in same PDB: d2a69a1, d2a69a2, d2a69b1, d2a69b2, d2a69c1, d2a69d1, d2a69e1, d2a69f1, d2a69f2, d2a69k1, d2a69k2, d2a69l1, d2a69l2, d2a69m1, d2a69n1, d2a69o1, d2a69p1, d2a69p2 automatically matched to d1iw7f3 complexed with mg, rpt, zn |
PDB Entry: 2a69 (more details), 2.5 Å
SCOP Domain Sequences for d2a69f3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a69f3 a.177.1.1 (F:74-257) Sigma70 {Thermus thermophilus [TaxId: 274]}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qart
Timeline for d2a69f3: