Lineage for d2a0sa1 (2a0s A:18-180)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531295Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2531296Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2531465Family d.96.1.2: 6-pyruvoyl tetrahydropterin synthase [55625] (2 proteins)
  6. 2531466Protein 6-pyruvoyl tetrahydropterin synthase [55626] (4 species)
    beta-sheets of three subunits form a barrel, closed: n=12, S=12
  7. 2531480Species Plasmodium vivax [TaxId:5855] [143629] (1 PDB entry)
    73% similarity to the Plasmodium falciparum enzyme
  8. 2531481Domain d2a0sa1: 2a0s A:18-180 [125962]
    complexed with bio, zn

Details for d2a0sa1

PDB Entry: 2a0s (more details), 2.2 Å

PDB Description: Crystal structure of 6-pyruvoyl tetrahydropterin synthase (PTPS) from Plasmodium vivax at 2.2 A resolution
PDB Compounds: (A:) 6-pyruvoyl tetrahydropterin synthase

SCOPe Domain Sequences for d2a0sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a0sa1 d.96.1.2 (A:18-180) 6-pyruvoyl tetrahydropterin synthase {Plasmodium vivax [TaxId: 5855]}
dqiaellvesplfsfncahfiafkgfretlhghnynvslrlrgniqgdgyvidfsilkek
vrkvckqldhhfilpmysdvlniqevndnfkitcednseysfpkrdcvqipikhssteei
glyilnqlieeidlpflktrsvnymevtvsespsqkatvhrni

SCOPe Domain Coordinates for d2a0sa1:

Click to download the PDB-style file with coordinates for d2a0sa1.
(The format of our PDB-style files is described here.)

Timeline for d2a0sa1: