PDB entry 2a0s

View 2a0s on RCSB PDB site
Description: Crystal structure of 6-pyruvoyl tetrahydropterin synthase (PTPS) from Plasmodium vivax at 2.2 A resolution
Class: lyase, biosynthetic protein
Keywords: SGPP, Structural GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, 6-pyruvoyl tetrahydropterin synthase, PTPS, Plasmodium, vivax, Structural Genomics of Pathogenic Protozoa Consortium, LYASE, BIOSYNTHETIC PROTEIN
Deposited on 2005-06-16, released 2005-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-pyruvoyl tetrahydropterin synthase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: MAL6P1.148
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a0sa1
  • Chain 'B':
    Compound: 6-pyruvoyl tetrahydropterin synthase
    Species: Plasmodium vivax [TaxId:5855]
    Gene: MAL6P1.148
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2a0sb_
  • Heterogens: ZN, BIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a0sA (A:)
    mahhhhhhmnphpveprdqiaellvesplfsfncahfiafkgfretlhghnynvslrlrg
    niqgdgyvidfsilkekvrkvckqldhhfilpmysdvlniqevndnfkitcednseysfp
    krdcvqipikhssteeiglyilnqlieeidlpflktrsvnymevtvsespsqkatvhrni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a0sA (A:)
    dqiaellvesplfsfncahfiafkgfretlhghnynvslrlrgniqgdgyvidfsilkek
    vrkvckqldhhfilpmysdvlniqevndnfkitcednseysfpkrdcvqipikhssteei
    glyilnqlieeidlpflktrsvnymevtvsespsqkatvhrni
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a0sB (B:)
    mahhhhhhmnphpveprdqiaellvesplfsfncahfiafkgfretlhghnynvslrlrg
    niqgdgyvidfsilkekvrkvckqldhhfilpmysdvlniqevndnfkitcednseysfp
    krdcvqipikhssteeiglyilnqlieeidlpflktrsvnymevtvsespsqkatvhrni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a0sB (B:)
    dqiaellvesplfsfncahfiafkgfretlhghnynvslrlrgniqgdgyvidfsilkek
    vrkvckqldhhfilpmysdvlniqevndnfkitcednseysfpkrdcvqipikhssteei
    glyilnqlieeidlpflktrsvnymevtvsespsqkatvhrni