SCOPe 2.08: Domain d2a0fd2: 2a0f D:101-153

Lineage for d2a0fd2 (2a0f D:101-153)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families)
   automatically mapped to Pfam PF02748

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)

7. Species Escherichia coli [TaxId:562] [57828] (62 PDB entries)
   Uniprot P00478

8. Domain d2a0fd2: 2a0f D:101-153 [125953]
   Other proteins in same PDB: d2a0fa1, d2a0fa2, d2a0fb1, d2a0fc1, d2a0fc2, d2a0fd1
   automated match to d1d09b2
   complexed with pct, zn; mutant

Details for d2a0fd2

PDB Entry: 2a0f, 2.9 Å

PDB Description: structure of d236a mutant e. coli aspartate transcarbamoylase in presence of phosphonoacetamide at 2.90 a resolution

PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2a0fd2:

Sequence; same for both SEQRES and ATOM records:

>d2a0fd2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d2a0fd2:

• d2a0fd2 first appeared in SCOP 1.73
  
• d2a0fd2 appears in SCOPe 2.07