![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) ![]() automatically mapped to Pfam PF01948 |
![]() | Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) |
![]() | Protein Aspartate carbamoyltransferase [54895] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [54896] (62 PDB entries) Uniprot P00478 |
![]() | Domain d2a0fb1: 2a0f B:8-100 [125948] Other proteins in same PDB: d2a0fa1, d2a0fa2, d2a0fb2, d2a0fc1, d2a0fc2, d2a0fd2 automated match to d1d09b1 complexed with pct, zn; mutant |
PDB Entry: 2a0f (more details), 2.9 Å
SCOPe Domain Sequences for d2a0fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a0fb1 d.58.2.1 (B:8-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]} qveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls edqvdqlalyapqatvnridnyevvgksrpslp
Timeline for d2a0fb1: