Lineage for d2a0fc1 (2a0f C:1-150)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2479956Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2479957Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2479958Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 protein domains)
  6. 2479959Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2479967Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
    Uniprot P00479
  8. 2480232Domain d2a0fc1: 2a0f C:1-150 [125950]
    Other proteins in same PDB: d2a0fb1, d2a0fb2, d2a0fd1, d2a0fd2
    automatically matched to d1ekxa1
    complexed with pct, zn; mutant

Details for d2a0fc1

PDB Entry: 2a0f (more details), 2.9 Å

PDB Description: structure of d236a mutant e. coli aspartate transcarbamoylase in presence of phosphonoacetamide at 2.90 a resolution
PDB Compounds: (C:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d2a0fc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a0fc1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOPe Domain Coordinates for d2a0fc1:

Click to download the PDB-style file with coordinates for d2a0fc1.
(The format of our PDB-style files is described here.)

Timeline for d2a0fc1: