![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) ![]() automatically mapped to Pfam PF02748 |
![]() | Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein) |
![]() | Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [57828] (62 PDB entries) Uniprot P00478 |
![]() | Domain d2a0fb2: 2a0f B:101-153 [125949] Other proteins in same PDB: d2a0fa1, d2a0fa2, d2a0fb1, d2a0fc1, d2a0fc2, d2a0fd1 automated match to d1d09b2 complexed with pct, zn; mutant |
PDB Entry: 2a0f (more details), 2.9 Å
SCOPe Domain Sequences for d2a0fb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a0fb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]} eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan
Timeline for d2a0fb2: