SCOPe 2.08: Domain d1zo8i_: 1zo8 I:

Lineage for d1zo8i_ (1zo8 I:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein Halohydrin dehalogenase HheC [102153] (1 species)
   haloalcohol dehalogenase: evolved a new activity; lost the NAD-binding site

7. Species Agrobacterium tumefaciens [TaxId:358] [102154] (5 PDB entries)

8. Domain d1zo8i_: 1zo8 I: [125426]
   automated match to d1pwxa_
   complexed with sno

Details for d1zo8i_

PDB Entry: 1zo8, 1.9 Å

PDB Description: X-ray Structure of the haloalcohol dehalogenase HheC of Agrobacterium radiobacter AD1 in complex with (S)-para-nitrostyrene oxide, with a water molecule in the halide-binding site

PDB Compounds: (I:) halohydrin dehalogenase

SCOPe Domain Sequences for d1zo8i_:

Sequence; same for both SEQRES and ATOM records:

>d1zo8i_ c.2.1.2 (I:) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]}
staivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepae
lieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmkk
rksghiifitsatpfgpwkelstytsaragactlanalskelgeynipvfaigpnylhse
dspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwlag
gfpmierwpgmp

Timeline for d1zo8i_:

• d1zo8i_ first appeared in SCOP 1.73, called d1zo8i1
  
• d1zo8i_ appears in SCOPe 2.07