![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
![]() | Protein Halohydrin dehalogenase HheC [102153] (1 species) haloalcohol dehalogenase: evolved a new activity; lost the NAD-binding site |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [102154] (5 PDB entries) |
![]() | Domain d1zo8h_: 1zo8 H: [125425] automated match to d1pwxa_ complexed with sno |
PDB Entry: 1zo8 (more details), 1.9 Å
SCOPe Domain Sequences for d1zo8h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zo8h_ c.2.1.2 (H:) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} staivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepae lieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmkk rksghiifitsatpfgpwkelstytsaragactlanalskelgeynipvfaigpnylhse dspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwlag gfpmierwpgmp
Timeline for d1zo8h_: