SCOP 1.73: Domain d1zo8h1: 1zo8 H:2-253

Lineage for d1zo8h1 (1zo8 H:2-253)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Halohydrin dehalogenase HheC [102153] (1 species)
   haloalcohol dehalogenase: evolved a new activity; lost the NAD-binding site

7. Species Agrobacterium tumefaciens [TaxId:358] [102154] (5 PDB entries)

8. Domain d1zo8h1: 1zo8 H:2-253 [125425]
   automatically matched to d1pwxa_
   complexed with sno

Details for d1zo8h1

PDB Entry: 1zo8, 1.9 Å

PDB Description: X-ray Structure of the haloalcohol dehalogenase HheC of Agrobacterium radiobacter AD1 in complex with (S)-para-nitrostyrene oxide, with a water molecule in the halide-binding site

PDB Compounds: (H:) halohydrin dehalogenase

SCOP Domain Sequences for d1zo8h1:

Sequence; same for both SEQRES and ATOM records:

>d1zo8h1 c.2.1.2 (H:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]}
staivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepae
lieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmkk
rksghiifitsatpfgpwkelstytsaragactlanalskelgeynipvfaigpnylhse
dspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwlag
gfpmierwpgmp

Timeline for d1zo8h1:

• d1zo8h1 is new in SCOP 1.73
  
• d1zo8h1 appears in SCOP 1.75
  
• d1zo8h1 appears in the current release, SCOPe 2.08, called d1zo8h_