Lineage for d1zo8f_ (1zo8 F:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. Protein Halohydrin dehalogenase HheC [102153] (1 species)
    haloalcohol dehalogenase: evolved a new activity; lost the NAD-binding site
  7. Species Agrobacterium tumefaciens [TaxId:358] [102154] (5 PDB entries)
  8. Domain d1zo8f_: 1zo8 F: [125423]
    automated match to d1pwxa_
    complexed with sno

Details for d1zo8f_

PDB Entry: 1zo8 (more details), 1.9 Å

PDB Description: X-ray Structure of the haloalcohol dehalogenase HheC of Agrobacterium radiobacter AD1 in complex with (S)-para-nitrostyrene oxide, with a water molecule in the halide-binding site
PDB Compounds: (F:) halohydrin dehalogenase

SCOPe Domain Sequences for d1zo8f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zo8f_ c.2.1.2 (F:) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]}
staivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepae
lieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmkk
rksghiifitsatpfgpwkelstytsaragactlanalskelgeynipvfaigpnylhse
dspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwlag
gfpmierwpgmp

SCOPe Domain Coordinates for d1zo8f_ are not available.

Timeline for d1zo8f_:

Domains from other chains:
(mouse over for more information)
d1zo8a_, d1zo8b_, d1zo8c_, d1zo8d_, d1zo8e_, d1zo8g_, d1zo8h_, d1zo8i_, d1zo8j_, d1zo8k_, d1zo8l_, d1zo8m_, d1zo8n_, d1zo8o_, d1zo8p_