Lineage for d1zo8i1 (1zo8 I:2-253)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 686289Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 686864Protein Halohydrin dehalogenase HheC [102153] (1 species)
    haloalcohol dehalogenase: evolved a new activity; lost the NAD-binding site
  7. 686865Species Agrobacterium tumefaciens [TaxId:358] [102154] (5 PDB entries)
  8. 686882Domain d1zo8i1: 1zo8 I:2-253 [125426]
    automatically matched to d1pwxa_
    complexed with sno

Details for d1zo8i1

PDB Entry: 1zo8 (more details), 1.9 Å

PDB Description: X-ray Structure of the haloalcohol dehalogenase HheC of Agrobacterium radiobacter AD1 in complex with (S)-para-nitrostyrene oxide, with a water molecule in the halide-binding site
PDB Compounds: (I:) halohydrin dehalogenase

SCOP Domain Sequences for d1zo8i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zo8i1 c.2.1.2 (I:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]}
staivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepae
lieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmkk
rksghiifitsatpfgpwkelstytsaragactlanalskelgeynipvfaigpnylhse
dspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwlag
gfpmierwpgmp

SCOP Domain Coordinates for d1zo8i1:

Click to download the PDB-style file with coordinates for d1zo8i1.
(The format of our PDB-style files is described here.)

Timeline for d1zo8i1: