SCOPe 2.08: Domain d1ze1b2: 1ze1 B:1-228

Lineage for d1ze1b2 (1ze1 B:1-228)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (5 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins)
   contains C-terminal PUA domain

6. Protein Pseudouridine synthase II TruB [69747] (5 species)

7. Species Thermotoga maritima [TaxId:2336] [103016] (4 PDB entries)

8. Domain d1ze1b2: 1ze1 B:1-228 [124965]
   Other proteins in same PDB: d1ze1a1, d1ze1b1, d1ze1c1, d1ze1d1
   automated match to d1r3ea2
   complexed with mg

Details for d1ze1b2

PDB Entry: 1ze1, 2.9 Å

PDB Description: Conformational Change of Pseudouridine 55 Synthase upon Its Association with RNA Substrate

PDB Compounds: (B:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d1ze1b2:

Sequence; same for both SEQRES and ATOM records:

>d1ze1b2 d.265.1.2 (B:1-228) Pseudouridine synthase II TruB {Thermotoga maritima [TaxId: 2336]}
mkhgilvaykpkgptshdvvdevrkklktrkvghggtldpfacgvliigvnqgtrilefy
kdlkkvywvkmrlglitetfditgevveerecnvteeeireaifsfvgeydqvppaysak
kykgerlyklaregkiinlppkrvkifkiwdvniegrdvsfrvevspgtyirslcmdigy
klgcgatavelvresvgphtieeslnvfeaapeeienriiplekclew

Timeline for d1ze1b2:

• d1ze1b2 first appeared in SCOP 1.73
  
• d1ze1b2 appears in SCOPe 2.07