![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.265: Pseudouridine synthase [100877] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
![]() | Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) ![]() the active site is the most conserved structural region of the superfamily and is located between the subdomains |
![]() | Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins) contains C-terminal PUA domain |
![]() | Protein Pseudouridine synthase II TruB [69747] (5 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [103016] (4 PDB entries) |
![]() | Domain d1ze1c2: 1ze1 C:1-228 [124967] Other proteins in same PDB: d1ze1a1, d1ze1b1, d1ze1c1, d1ze1d1 automated match to d1r3ea2 complexed with mg |
PDB Entry: 1ze1 (more details), 2.9 Å
SCOPe Domain Sequences for d1ze1c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ze1c2 d.265.1.2 (C:1-228) Pseudouridine synthase II TruB {Thermotoga maritima [TaxId: 2336]} mkhgilvaykpkgptshdvvdevrkklktrkvghggtldpfacgvliigvnqgtrilefy kdlkkvywvkmrlglitetfditgevveerecnvteeeireaifsfvgeydqvppaysak kykgerlyklaregkiinlppkrvkifkiwdvniegrdvsfrvevspgtyirslcmdigy klgcgatavelvresvgphtieeslnvfeaapeeienriiplekclew
Timeline for d1ze1c2: