Lineage for d1ze1d2 (1ze1 D:1-228)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009172Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 3009173Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 3009188Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins)
    contains C-terminal PUA domain
  6. 3009189Protein Pseudouridine synthase II TruB [69747] (5 species)
  7. 3009205Species Thermotoga maritima [TaxId:2336] [103016] (4 PDB entries)
  8. 3009211Domain d1ze1d2: 1ze1 D:1-228 [124969]
    Other proteins in same PDB: d1ze1a1, d1ze1b1, d1ze1c1, d1ze1d1
    automated match to d1r3ea2
    complexed with mg

Details for d1ze1d2

PDB Entry: 1ze1 (more details), 2.9 Å

PDB Description: Conformational Change of Pseudouridine 55 Synthase upon Its Association with RNA Substrate
PDB Compounds: (D:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d1ze1d2:

Sequence, based on SEQRES records: (download)

>d1ze1d2 d.265.1.2 (D:1-228) Pseudouridine synthase II TruB {Thermotoga maritima [TaxId: 2336]}
mkhgilvaykpkgptshdvvdevrkklktrkvghggtldpfacgvliigvnqgtrilefy
kdlkkvywvkmrlglitetfditgevveerecnvteeeireaifsfvgeydqvppaysak
kykgerlyklaregkiinlppkrvkifkiwdvniegrdvsfrvevspgtyirslcmdigy
klgcgatavelvresvgphtieeslnvfeaapeeienriiplekclew

Sequence, based on observed residues (ATOM records): (download)

>d1ze1d2 d.265.1.2 (D:1-228) Pseudouridine synthase II TruB {Thermotoga maritima [TaxId: 2336]}
mkhgilvaykpkgptshdvvdevrkklktrkvghggtldpfacgvliigvnqgtrilefy
kdlkkvywvkmrlglitetfditgevveerecnvteeeireaifsfvgeydqvppapkrv
kifkiwdvniegrdvsfrvevspgtyirslcmdigyklgcgatavelvresvgphtiees
lnvfeaapeeienriiplekclew

SCOPe Domain Coordinates for d1ze1d2:

Click to download the PDB-style file with coordinates for d1ze1d2.
(The format of our PDB-style files is described here.)

Timeline for d1ze1d2: