![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (15 families) ![]() |
![]() | Family b.122.1.1: PUA domain [88698] (6 proteins) RNA-binding domain |
![]() | Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [102023] (4 PDB entries) |
![]() | Domain d1ze1d1: 1ze1 D:229-308 [124968] Other proteins in same PDB: d1ze1a2, d1ze1b2, d1ze1c2, d1ze1d2 automated match to d1r3ea1 complexed with mg |
PDB Entry: 1ze1 (more details), 2.9 Å
SCOPe Domain Sequences for d1ze1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ze1d1 b.122.1.1 (D:229-308) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima [TaxId: 2336]} lprvvvhqestkmilngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfle tlrkherqrrvltlrkvfqt
Timeline for d1ze1d1: