Lineage for d1ze1b1 (1ze1 B:229-308)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2823866Family b.122.1.1: PUA domain [88698] (6 proteins)
    RNA-binding domain
  6. 2823889Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species)
  7. 2823905Species Thermotoga maritima [TaxId:2336] [102023] (4 PDB entries)
  8. 2823909Domain d1ze1b1: 1ze1 B:229-308 [124964]
    Other proteins in same PDB: d1ze1a2, d1ze1b2, d1ze1c2, d1ze1d2
    automated match to d1r3ea1
    complexed with mg

Details for d1ze1b1

PDB Entry: 1ze1 (more details), 2.9 Å

PDB Description: Conformational Change of Pseudouridine 55 Synthase upon Its Association with RNA Substrate
PDB Compounds: (B:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d1ze1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ze1b1 b.122.1.1 (B:229-308) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lprvvvhqestkmilngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfle
tlrkherqrrvltlrkvfqt

SCOPe Domain Coordinates for d1ze1b1:

Click to download the PDB-style file with coordinates for d1ze1b1.
(The format of our PDB-style files is described here.)

Timeline for d1ze1b1: