Lineage for d1yxmd_ (1yxm D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842666Protein Peroxisomal trans 2-enoyl CoA reductase [141884] (1 species)
  7. 2842667Species Human (Homo sapiens) [TaxId:9606] [141885] (1 PDB entry)
    Uniprot Q9BY49 7-303
  8. 2842671Domain d1yxmd_: 1yxm D: [124195]
    automated match to d1yxma1
    complexed with ade, po4, so4

Details for d1yxmd_

PDB Entry: 1yxm (more details), 1.9 Å

PDB Description: Crystal structure of peroxisomal trans 2-enoyl CoA reductase
PDB Compounds: (D:) peroxisomal trans 2-enoyl CoA reductase

SCOPe Domain Sequences for d1yxmd_:

Sequence, based on SEQRES records: (download)

>d1yxmd_ c.2.1.2 (D:) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
rsylapgllqgqvaivtggatgigkaivkellelgsnvviasrklerlksaadelqanlp
ptkqarvipiqcnirneeevnnlvkstldtfgkinflvnngggqflspaehisskgwhav
letnltgtfymckavysswmkehggsivniivptkagfplavhsgaaragvynltkslal
ewacsgirincvapgviysqtavenygswgqsffegsfqkipakrigvpeevssvvcfll
spaasfitgqsvdvdggrslythsyevpdhdnwpkgagdlsvvkkmketfkekakl

Sequence, based on observed residues (ATOM records): (download)

>d1yxmd_ c.2.1.2 (D:) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
rsylapgllqgqvaivtggatgigkaivkellelgsnvviasrklerlksaadelqanla
rvipiqcnirneeevnnlvkstldtfgkinflvnngggqflspaehisskgwhavletnl
tgtfymckavysswmkehggsivniivptkagfplavhsgaaragvynltkslalewacs
girincvapgviysqtavenygswgqsffegsfqkipakrigvpeevssvvcfllspaas
fitgqsvdvdggrslythsyevpdhdnwpkgagdlsvvkkmketfkekakl

SCOPe Domain Coordinates for d1yxmd_:

Click to download the PDB-style file with coordinates for d1yxmd_.
(The format of our PDB-style files is described here.)

Timeline for d1yxmd_: