SCOPe 2.08: Domain d1yxmb_: 1yxm B:

Lineage for d1yxmb_ (1yxm B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein Peroxisomal trans 2-enoyl CoA reductase [141884] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141885] (1 PDB entry)
   Uniprot Q9BY49 7-303

8. Domain d1yxmb_: 1yxm B: [124193]
   automated match to d1yxma1
   complexed with ade, po4, so4

Details for d1yxmb_

PDB Entry: 1yxm, 1.9 Å

PDB Description: Crystal structure of peroxisomal trans 2-enoyl CoA reductase

PDB Compounds: (B:) peroxisomal trans 2-enoyl CoA reductase

SCOPe Domain Sequences for d1yxmb_:

Sequence, based on SEQRES records:

>d1yxmb_ c.2.1.2 (B:) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
rsylapgllqgqvaivtggatgigkaivkellelgsnvviasrklerlksaadelqanlp
ptkqarvipiqcnirneeevnnlvkstldtfgkinflvnngggqflspaehisskgwhav
letnltgtfymckavysswmkehggsivniivptkagfplavhsgaaragvynltkslal
ewacsgirincvapgviysqtavenygswgqsffegsfqkipakrigvpeevssvvcfll
spaasfitgqsvdvdggrslythsyevpdhdnwpkgagdlsvvkkmketfk

Sequence, based on observed residues (ATOM records):

>d1yxmb_ c.2.1.2 (B:) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
rsylapgllqgqvaivtggatgigkaivkellelgsnvviasrklerlksaadelqanlp
ptkqarvipiqcnirneeevnnlvkstldtfgkinflvnngggqflspaehisskgwhav
letnltgtfymckavysswmkehggsivniivptkagfplavhsgaaragvynltkslal
ewacsgirincvapgviysqtaqsffegsfqkipakrigvpeevssvvcfllspaasfit
gqsvdvdggrslythsyevpdhdnwpkgagdlsvvkkmketfk

Timeline for d1yxmb_:

• d1yxmb_ first appeared in SCOP 1.73, called d1yxmb1
  
• d1yxmb_ appears in SCOPe 2.07