PDB entry 1yxm

View 1yxm on RCSB PDB site
Description: Crystal structure of peroxisomal trans 2-enoyl CoA reductase
Class: oxidoreductase
Keywords: perioxisomes, fatty acid synthesis, enoyl CoA, short-chain dehydrogenases/reductases, Structural Genomics, Structural Genomics Consortium, SGC, OXIDOREDUCTASE
Deposited on 2005-02-22, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.206
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxisomal trans 2-enoyl CoA reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: pecr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yxma1
  • Chain 'B':
    Compound: peroxisomal trans 2-enoyl CoA reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: pecr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yxmb_
  • Chain 'C':
    Compound: peroxisomal trans 2-enoyl CoA reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: pecr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yxmc_
  • Chain 'D':
    Compound: peroxisomal trans 2-enoyl CoA reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: pecr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yxmd_
  • Heterogens: SO4, PO4, ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yxmA (A:)
    maswakgrsylapgllqgqvaivtggatgigkaivkellelgsnvviasrklerlksaad
    elqanlpptkqarvipiqcnirneeevnnlvkstldtfgkinflvnngggqflspaehis
    skgwhavletnltgtfymckavysswmkehggsivniivptkagfplavhsgaaragvyn
    ltkslalewacsgirincvapgviysqtavenygswgqsffegsfqkipakrigvpeevs
    svvcfllspaasfitgqsvdvdggrslythsyevpdhdnwpkgagdlsvvkkmketfkek
    akl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxmA (A:)
    grsylapgllqgqvaivtggatgigkaivkellelgsnvviasrklerlksaadelqanl
    pptkqarvipiqcnirneeevnnlvkstldtfgkinflvnngggqflspaehisskgwha
    vletnltgtfymckavysswmkehggsivniivptkagfplavhsgaaragvynltksla
    lewacsgirincvapgviysqtavenygswgqsffegsfqkipakrigvpeevssvvcfl
    lspaasfitgqsvdvdggrslythsyevpdhdnwpkgagdlsvvkkmketfkekakl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yxmB (B:)
    maswakgrsylapgllqgqvaivtggatgigkaivkellelgsnvviasrklerlksaad
    elqanlpptkqarvipiqcnirneeevnnlvkstldtfgkinflvnngggqflspaehis
    skgwhavletnltgtfymckavysswmkehggsivniivptkagfplavhsgaaragvyn
    ltkslalewacsgirincvapgviysqtavenygswgqsffegsfqkipakrigvpeevs
    svvcfllspaasfitgqsvdvdggrslythsyevpdhdnwpkgagdlsvvkkmketfkek
    akl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxmB (B:)
    rsylapgllqgqvaivtggatgigkaivkellelgsnvviasrklerlksaadelqanlp
    ptkqarvipiqcnirneeevnnlvkstldtfgkinflvnngggqflspaehisskgwhav
    letnltgtfymckavysswmkehggsivniivptkagfplavhsgaaragvynltkslal
    ewacsgirincvapgviysqtaqsffegsfqkipakrigvpeevssvvcfllspaasfit
    gqsvdvdggrslythsyevpdhdnwpkgagdlsvvkkmketfk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yxmC (C:)
    maswakgrsylapgllqgqvaivtggatgigkaivkellelgsnvviasrklerlksaad
    elqanlpptkqarvipiqcnirneeevnnlvkstldtfgkinflvnngggqflspaehis
    skgwhavletnltgtfymckavysswmkehggsivniivptkagfplavhsgaaragvyn
    ltkslalewacsgirincvapgviysqtavenygswgqsffegsfqkipakrigvpeevs
    svvcfllspaasfitgqsvdvdggrslythsyevpdhdnwpkgagdlsvvkkmketfkek
    akl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxmC (C:)
    akgrsylapgllqgqvaivtggatgigkaivkellelgsnvviasrklerlksaadelqa
    nlkqarvipiqcnirneeevnnlvkstldtfgkinflvnngwhavletnltgtfymckav
    ysswmkehggsivniivpgfplavhsgaaragvynltkslalewacsgirincvapgviy
    sqtavfegsfqkipakrigvpeevssvvcfllspaasfitgqsvdvdggrslythsyevp
    dhdnwpkgagdlsvvkkmketfke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yxmD (D:)
    maswakgrsylapgllqgqvaivtggatgigkaivkellelgsnvviasrklerlksaad
    elqanlpptkqarvipiqcnirneeevnnlvkstldtfgkinflvnngggqflspaehis
    skgwhavletnltgtfymckavysswmkehggsivniivptkagfplavhsgaaragvyn
    ltkslalewacsgirincvapgviysqtavenygswgqsffegsfqkipakrigvpeevs
    svvcfllspaasfitgqsvdvdggrslythsyevpdhdnwpkgagdlsvvkkmketfkek
    akl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxmD (D:)
    rsylapgllqgqvaivtggatgigkaivkellelgsnvviasrklerlksaadelqanla
    rvipiqcnirneeevnnlvkstldtfgkinflvnngggqflspaehisskgwhavletnl
    tgtfymckavysswmkehggsivniivptkagfplavhsgaaragvynltkslalewacs
    girincvapgviysqtavenygswgqsffegsfqkipakrigvpeevssvvcfllspaas
    fitgqsvdvdggrslythsyevpdhdnwpkgagdlsvvkkmketfkekakl