Lineage for d1yvpb1 (1yvp B:4-363)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2008013Superfamily a.118.25: TROVE domain-like [140864] (1 family) (S)
    consist of two superhelical sections arranged like a horse-shoe
    automatically mapped to Pfam PF05731
  5. 2008014Family a.118.25.1: TROVE domain-like [140865] (1 protein)
    Pfam PF05731
  6. 2008015Protein 60-kda SS-aARo ribonucleoprotein [140866] (1 species)
  7. 2008016Species African clawed frog (Xenopus laevis) [TaxId:8355] [140867] (3 PDB entries)
    Uniprot P42700 5-363
  8. 2008019Domain d1yvpb1: 1yvp B:4-363 [124110]
    Other proteins in same PDB: d1yvpa2, d1yvpb2
    automated match to d1yvpa1
    protein/RNA complex; complexed with act, mg

Details for d1yvpb1

PDB Entry: 1yvp (more details), 2.2 Å

PDB Description: Ro autoantigen complexed with RNAs
PDB Compounds: (B:) 60-kDa SS-A/Ro ribonucleoprotein

SCOPe Domain Sequences for d1yvpb1:

Sequence, based on SEQRES records: (download)

>d1yvpb1 a.118.25.1 (B:4-363) 60-kda SS-aARo ribonucleoprotein {African clawed frog (Xenopus laevis) [TaxId: 8355]}
tmdqtqplnekqvpnsegcyvwqvsdmnrlrrflcfgseggtyyieekklgqenaeallr
liedgkgcevvqeiktfsqegraakqeptlfalavcsqcsdiktkqaafravpevcript
hlftfiqfkkdlkegmkcgmwgralrkavsdwyntkdalnlamavtkykqrngwshkdll
rlshikpanegltmvakyvskgwkevqeaykekelspetekvlkyleatervkrtkdele
iihlideyrlvrehlltihlkskeiwksllqdmpltallrnlgkmtadsvlapassevss
vcerltnekllkkarihpfhilvaletykkghgnrgklrwipdtsivealdnafyksfkl

Sequence, based on observed residues (ATOM records): (download)

>d1yvpb1 a.118.25.1 (B:4-363) 60-kda SS-aARo ribonucleoprotein {African clawed frog (Xenopus laevis) [TaxId: 8355]}
tmdqtqplnekqvpnsegcyvwqvsdmnrlrrflcfgseggtyyieekklgqenaeallr
liedgkgcevvqeiktfsqegraakqeptlfalavcsqcsdiktkqaafravpevcript
hlftfiqfkkdlkegmkcgmwgralrkavsdwyntkdalnlamavtkykqrngwshkdll
rlshikpanegltmvakyvskgwkevqeaykekelspetekvlkyleatervkrtkdele
iihlideyrlvrehlltihlkskeiwksllqdmpltallrnlgkmtadsvlapassevss
vcerltnekllkkarihpfhilvaletykkghgnklrwipdtsivealdnafyksfkl

SCOPe Domain Coordinates for d1yvpb1:

Click to download the PDB-style file with coordinates for d1yvpb1.
(The format of our PDB-style files is described here.)

Timeline for d1yvpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yvpb2