SCOPe 2.08: Domain d1yvpb2: 1yvp B:364-537

Lineage for d1yvpb2 (1yvp B:364-537)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.5: RoRNP C-terminal domain-like [142565] (1 protein)

6. Protein 60-kda SS-A/Ro ribonucleoprotein, RoRNP [142566] (1 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [142567] (3 PDB entries)
   Uniprot P42700 364-537

8. Domain d1yvpb2: 1yvp B:364-537 [124111]
   Other proteins in same PDB: d1yvpa1, d1yvpb1
   automated match to d1yvpa2
   protein/RNA complex; complexed with act, mg

Details for d1yvpb2

PDB Entry: 1yvp, 2.2 Å

PDB Description: Ro autoantigen complexed with RNAs

PDB Compounds: (B:) 60-kDa SS-A/Ro ribonucleoprotein

SCOPe Domain Sequences for d1yvpb2:

Sequence; same for both SEQRES and ATOM records:

>d1yvpb2 c.62.1.5 (B:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]}
veptgkrfllaidvsasmnqrvlgsilnasvvaaamcmlvartekdshmvafsdemlpcp
itvnmllhevvekmsditmgstdcalpmlwaqktntaadifivftdcetnvedvhpatal
kqyrekmgipaklivcamtsngfsiadpddrgmldicgfdsgaldvirnftldl

Timeline for d1yvpb2:

• d1yvpb2 first appeared in SCOP 1.73
  
• d1yvpb2 appears in SCOPe 2.07