Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) |
Family c.62.1.5: RoRNP C-terminal domain-like [142565] (1 protein) |
Protein 60-kda SS-A/Ro ribonucleoprotein, RoRNP [142566] (1 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [142567] (3 PDB entries) Uniprot P42700 364-537 |
Domain d1yvpa2: 1yvp A:364-537 [124109] Other proteins in same PDB: d1yvpa1, d1yvpb1 protein/RNA complex; complexed with act, mg |
PDB Entry: 1yvp (more details), 2.2 Å
SCOPe Domain Sequences for d1yvpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvpa2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]} veptgkrfllaidvsasmnqrvlgsilnasvvaaamcmlvartekdshmvafsdemlpcp itvnmllhevvekmsditmgstdcalpmlwaqktntaadifivftdcetnvedvhpatal kqyrekmgipaklivcamtsngfsiadpddrgmldicgfdsgaldvirnftldl
Timeline for d1yvpa2: