Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.14: NagD-like [102317] (7 proteins) duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family |
Protein automated matches [190164] (2 species) not a true protein |
Species Enterococcus faecalis [TaxId:226185] [186889] (1 PDB entry) |
Domain d1yv9b2: 1yv9 B:4-256 [124090] Other proteins in same PDB: d1yv9a1, d1yv9a2, d1yv9a3, d1yv9b3, d1yv9b4 automated match to d1wvia_ complexed with po4 |
PDB Entry: 1yv9 (more details), 2.8 Å
SCOPe Domain Sequences for d1yv9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yv9b2 c.108.1.14 (B:4-256) automated matches {Enterococcus faecalis [TaxId: 226185]} dyqgylidldgtiylgkepipagkrfverlqekdlpflfvtnnttkspetvaqrlanefd ihvpaslvytatlatidymkeanrgkkvfvigeaglidlileagfewdetnpdyvvvgld telsyekvvlatlaiqkgalfigtnpdkniptergllpgagsvvtfvetatqtkpvyigk pkaiimeraiahlgvekeqvimvgdnyetdiqsgiqngidsllvtsgftpksavptlptp ptyvvdsldewtf
Timeline for d1yv9b2: