SCOPe 2.08: Domain d1yv9b2: 1yv9 B:4-256

Lineage for d1yv9b2 (1yv9 B:4-256)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.14: NagD-like [102317] (7 proteins)
   duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family

6. Protein automated matches [190164] (2 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:226185] [186889] (1 PDB entry)

8. Domain d1yv9b2: 1yv9 B:4-256 [124090]
   Other proteins in same PDB: d1yv9a1, d1yv9a2, d1yv9a3, d1yv9b3, d1yv9b4
   automated match to d1wvia_
   complexed with po4

Details for d1yv9b2

PDB Entry: 1yv9, 2.8 Å

PDB Description: crystal structure of a had-like phosphatase from enterococcus faecalis v583

PDB Compounds: (B:) hydrolase, haloacid dehalogenase family

SCOPe Domain Sequences for d1yv9b2:

Sequence; same for both SEQRES and ATOM records:

>d1yv9b2 c.108.1.14 (B:4-256) automated matches {Enterococcus faecalis [TaxId: 226185]}
dyqgylidldgtiylgkepipagkrfverlqekdlpflfvtnnttkspetvaqrlanefd
ihvpaslvytatlatidymkeanrgkkvfvigeaglidlileagfewdetnpdyvvvgld
telsyekvvlatlaiqkgalfigtnpdkniptergllpgagsvvtfvetatqtkpvyigk
pkaiimeraiahlgvekeqvimvgdnyetdiqsgiqngidsllvtsgftpksavptlptp
ptyvvdsldewtf

Timeline for d1yv9b2:

• d1yv9b2 first appeared in SCOP 1.73, called d1yv9b1
  
• d1yv9b2 appears in SCOPe 2.07