Lineage for d1yv9a1 (1yv9 A:4-256)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. Family c.108.1.14: NagD-like [102317] (7 proteins)
    duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family
  6. Protein Putative hydrolase EF1188 [142173] (1 species)
  7. Species Enterococcus faecalis [TaxId:1351] [142174] (1 PDB entry)
    Uniprot Q836C7 4-256
  8. Domain d1yv9a1: 1yv9 A:4-256 [124089]
    Other proteins in same PDB: d1yv9a2, d1yv9a3, d1yv9b2, d1yv9b3, d1yv9b4
    complexed with po4

Details for d1yv9a1

PDB Entry: 1yv9 (more details), 2.8 Å

PDB Description: crystal structure of a had-like phosphatase from enterococcus faecalis v583
PDB Compounds: (A:) hydrolase, haloacid dehalogenase family

SCOPe Domain Sequences for d1yv9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]}
dyqgylidldgtiylgkepipagkrfverlqekdlpflfvtnnttkspetvaqrlanefd
ihvpaslvytatlatidymkeanrgkkvfvigeaglidlileagfewdetnpdyvvvgld
telsyekvvlatlaiqkgalfigtnpdkniptergllpgagsvvtfvetatqtkpvyigk
pkaiimeraiahlgvekeqvimvgdnyetdiqsgiqngidsllvtsgftpksavptlptp
ptyvvdsldewtf

SCOPe Domain Coordinates for d1yv9a1 are not available.

Timeline for d1yv9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yv9a2, d1yv9a3
View in 3D
Domains from other chains:
(mouse over for more information)
d1yv9b2, d1yv9b3, d1yv9b4