PDB entry 1yv9

View 1yv9 on RCSB PDB site
Description: Crystal structure of a HAD-like phosphatase from Enterococcus faecalis V583
Class: structural genomics, unknown function
Keywords: Hypothetical protein, hydrolase haloacid dehalogenase, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2005-02-15, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.219
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydrolase, haloacid dehalogenase family
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q836C7 (3-255)
      • cloning artifact (1-2)
      • expression tag (256-257)
    Domains in SCOPe 2.07: d1yv9a1, d1yv9a2, d1yv9a3
  • Chain 'B':
    Compound: hydrolase, haloacid dehalogenase family
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q836C7 (3-255)
      • cloning artifact (1-2)
      • expression tag (256-257)
    Domains in SCOPe 2.07: d1yv9b2, d1yv9b3, d1yv9b4
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yv9A (A:)
    msldyqgylidldgtiylgkepipagkrfverlqekdlpflfvtnnttkspetvaqrlan
    efdihvpaslvytatlatidymkeanrgkkvfvigeaglidlileagfewdetnpdyvvv
    gldtelsyekvvlatlaiqkgalfigtnpdkniptergllpgagsvvtfvetatqtkpvy
    igkpkaiimeraiahlgvekeqvimvgdnyetdiqsgiqngidsllvtsgftpksavptl
    ptpptyvvdsldewtfeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yv9A (A:)
    sldyqgylidldgtiylgkepipagkrfverlqekdlpflfvtnnttkspetvaqrlane
    fdihvpaslvytatlatidymkeanrgkkvfvigeaglidlileagfewdetnpdyvvvg
    ldtelsyekvvlatlaiqkgalfigtnpdkniptergllpgagsvvtfvetatqtkpvyi
    gkpkaiimeraiahlgvekeqvimvgdnyetdiqsgiqngidsllvtsgftpksavptlp
    tpptyvvdsldewtfeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yv9B (B:)
    msldyqgylidldgtiylgkepipagkrfverlqekdlpflfvtnnttkspetvaqrlan
    efdihvpaslvytatlatidymkeanrgkkvfvigeaglidlileagfewdetnpdyvvv
    gldtelsyekvvlatlaiqkgalfigtnpdkniptergllpgagsvvtfvetatqtkpvy
    igkpkaiimeraiahlgvekeqvimvgdnyetdiqsgiqngidsllvtsgftpksavptl
    ptpptyvvdsldewtfeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yv9B (B:)
    sldyqgylidldgtiylgkepipagkrfverlqekdlpflfvtnnttkspetvaqrlane
    fdihvpaslvytatlatidymkeanrgkkvfvigeaglidlileagfewdetnpdyvvvg
    ldtelsyekvvlatlaiqkgalfigtnpdkniptergllpgagsvvtfvetatqtkpvyi
    gkpkaiimeraiahlgvekeqvimvgdnyetdiqsgiqngidsllvtsgftpksavptlp
    tpptyvvdsldewtfeg