Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (23 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.14: NagD-like [102317] (6 proteins) duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family |
Protein Putative hydrolase EF1188 [142173] (1 species) |
Species Enterococcus faecalis [TaxId:1351] [142174] (1 PDB entry) |
Domain d1yv9b1: 1yv9 B:4-256 [124090] automatically matched to 1YV9 A:4-256 complexed with po4 |
PDB Entry: 1yv9 (more details), 2.8 Å
SCOP Domain Sequences for d1yv9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yv9b1 c.108.1.14 (B:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} dyqgylidldgtiylgkepipagkrfverlqekdlpflfvtnnttkspetvaqrlanefd ihvpaslvytatlatidymkeanrgkkvfvigeaglidlileagfewdetnpdyvvvgld telsyekvvlatlaiqkgalfigtnpdkniptergllpgagsvvtfvetatqtkpvyigk pkaiimeraiahlgvekeqvimvgdnyetdiqsgiqngidsllvtsgftpksavptlptp ptyvvdsldewtf
Timeline for d1yv9b1: