SCOPe 2.08: Domain d1yrha1: 1yrh A:4-199

Lineage for d1yrha1 (1yrh A:4-199)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.8: WrbA-like [117474] (3 proteins)

6. Protein Trp repressor binding protein WrbA [117475] (4 species)

7. Species Deinococcus radiodurans [TaxId:1299] [117476] (2 PDB entries)
   Uniprot Q9RYU4

8. Domain d1yrha1: 1yrh A:4-199 [123923]
   Other proteins in same PDB: d1yrha2, d1yrhb3, d1yrhc3, d1yrhd3, d1yrhf3, d1yrhg3, d1yrhh3
   complexed with fmn

Details for d1yrha1

PDB Entry: 1yrh, 3.11 Å

PDB Description: crystal structure of trp repressor binding protein wrba in complex with fmn

PDB Compounds: (A:) Trp repressor binding protein WrbA

SCOPe Domain Sequences for d1yrha1:

Sequence; same for both SEQRES and ATOM records:

>d1yrha1 c.23.5.8 (A:4-199) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]}
pvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanieam
kdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsaq
nvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendras
irhqvrrqveltakll

Timeline for d1yrha1:

• d1yrha1 first appeared in SCOP 1.73
  
• d1yrha1 appears in SCOPe 2.07